PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof003098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 260aa    MW: 28650.5 Da    PI: 4.9432
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-569133731PU_refplantGDBView CDS
PUT-157a-Saccharum_officinarum-569133730PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.11e-2074127356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  Sof003098  74 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 127
                5678*************************************************9 PP

2HD-ZIP_I/II131.33.7e-4273164192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk++++al+++++ L +++++Lr+++ 
    Sof003098  73 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFEALRADHDVLLQDNHRLRSQVV 164
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.18E-2067131IPR009057Homeodomain-like
PROSITE profilePS5007118.2269129IPR001356Homeobox domain
SMARTSM003892.0E-2072133IPR001356Homeobox domain
PfamPF000465.3E-1874127IPR001356Homeobox domain
CDDcd000862.02E-1874130No hitNo description
Gene3DG3DSA:1.10.10.606.0E-2275136IPR009057Homeodomain-like
PRINTSPR000311.4E-6100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000311.4E-6109125IPR000047Helix-turn-helix motif
PfamPF021836.0E-17129171IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MESGRLIFNA PGSGAGQMLF LDCGAAGGHG GGLFHRGGRP MLGLEEGRGV KRPFFTSPDE  60
LLEEEYYDEQ LPEKKRRLTP EQVHLLERSF EEENKLEPER KTELARKLGL QPRQVAVWFQ  120
NRRARWKTKQ LERDFDRLKA SFEALRADHD VLLQDNHRLR SQVVSLTEKL QEKEATEGGA  180
SAATDAAALP AVDDVKASLA DGVEEPTEPA EGAAAFEVQQ VKSEDRLSTG NGRSAVGDAD  240
ALVYGAGRRF AAVVDSXLEX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121129RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.180181e-142crown| inflorescence| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647837.11e-118PREDICTED: homeobox-leucine zipper protein HOX16 isoform X1
SwissprotQ6YWR41e-111HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLC0PAE81e-132C0PAE8_MAIZE; Uncharacterized protein
TrEMBLB6T9631e-132B6T963_MAIZE; Homeodomain leucine zipper protein CPHB-5
STRINGSb04g029080.11e-128(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-58homeobox 1